Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Swordfish Involtini with Roasted Vegetables

Thin swordfish steaks stuffed with breadcrumbs and herbs, baked until tender alongside potatoes, carrots, broccoli, and tomato. A restaurant-worthy Italian dinner ready in 25 minutes.

Total time
25 min
Servings
2
Calories
520
Protein
48g
Swordfish Involtini with Roasted Vegetables
elegantsimpleitalianfishtendercrispyweeknightdate-night

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oven to 400°F. Toss potatoes, carrots, broccoli, and tomato halves with olive oil, salt, and pepper on a sheet pan.

  2. Step 2

    Mix panko, parmesan, parsley, minced garlic, salt, and pepper in a small bowl until breadcrumb mixture is moist.

  3. Step 3

    Butterfly each swordfish steak by slicing horizontally without cutting all the way through, then opening like a book.

  4. Step 4

    Divide breadcrumb filling between the two steaks, pack gently into the center, then fold back over and secure with a toothpick.

  5. Step 5

    Nestle involtini among the vegetables, drizzle everything with olive oil, and bake until swordfish is opaque, 12–14 minutes.

  6. Step 6

    Serve immediately with lemon wedges alongside.

Tools you’ll need

  • sheet pan
  • small mixing bowl
  • sharp knife
  • toothpicks
  • oven set to 400°F

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.