Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Tablier de Sapeur

A classic French bistro dish of crispy beef tripe, breaded and pan-fried until golden. Served with a tangy mustard sauce, it's rustic, satisfying, and surprisingly elegant.

Total time
35 min
Servings
2
Calories
520
Protein
48g
Tablier de Sapeur
rusticelegantfrenchbeefcrispytenderweeknightdate-night

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the tripe dry with paper towels by pressing gently all over, removing excess moisture so the coating will stick better.

  2. Step 2

    Cut the tripe into 4-inch-long strips about 2 inches wide, aiming for roughly rectangular pieces that are easy to coat and flip.

  3. Step 3

    Pour the flour into a shallow bowl, the beaten eggs into a second shallow bowl, and the panko into a third shallow bowl.

  4. Step 4

    Working with one tripe piece at a time, coat it in flour on both sides, shaking off excess, then dip into the egg until fully covered.

  5. Step 5

    Press the egg-coated tripe into the panko, turning to coat both sides thickly and evenly, then place on a clean plate.

  6. Step 6

    Repeat coating with all remaining tripe pieces until all are breaded and resting on the plate.

  7. Step 7

    Heat the olive oil in a 12-inch skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 90 seconds.

  8. Step 8

    Place half the breaded tripe pieces in the hot oil, leaving space between each piece so they do not crowd the pan.

  9. Step 9

    Cook for 3 to 4 minutes until the surface turns a golden-brown color, like warm honey, then flip each piece carefully using a spatula.

  10. Step 10

    Cook the second side for 3 to 4 minutes until it is also golden brown, then transfer to a clean plate.

  11. Step 11

    Repeat cooking with the remaining breaded tripe pieces in the same oil, adding another 30 seconds to oil temperature if needed.

  12. Step 12

    Arrange the crispy tripe pieces on a serving plate or divide between two plates.

  13. Step 13

    Drizzle 1.5 tablespoons of Dijon mustard on the left side of each plate, or dollop it underneath the tripe if preferred.

Tools you’ll need

  • paper towels
  • cutting board
  • chef's knife
  • three shallow bowls
  • 12-inch stainless steel or cast iron skillet
  • metal or heat-resistant spatula
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.