Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Giant Crispy Taiwanese Fried Chicken

Paper-thin pounded chicken breast, seasoned and fried golden until shattering-crispy on the outside and juicy within. Ready in 25 minutes with proper oil temperature control.

Total time
25 min
Servings
2
Calories
520
Protein
42g
Giant Crispy Taiwanese Fried Chicken
satisfyingsimpletaiwanesechickencrispyjuicysnackweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Place chicken on a cutting board. Slice each breast horizontally in half, creating two thinner cutlets.

  2. Step 2

    Pound cutlets between plastic wrap to 1/4-inch thickness using a meat mallet with steady, even strikes.

  3. Step 3

    Mix flour, cornstarch, salt, and white pepper in a shallow bowl. Pat cutlets dry, then coat both sides evenly.

  4. Step 4

    Heat oil in a 12-inch skillet to exactly 350°F (use a thermometer). Oil should shimmer and a flour pinch should bubble immediately.

  5. Step 5

    Carefully slide one cutlet into oil. Fry without moving for 3–4 minutes until bottom is deep golden brown.

  6. Step 6

    Flip once and fry the other side 2–3 minutes until edges curl and coating shatters when pressed lightly.

  7. Step 7

    Transfer to a paper-towel-lined plate. Repeat with second cutlet. Serve hot while crust is still crackling.

Tools you’ll need

  • cutting board
  • meat mallet
  • plastic wrap
  • shallow bowl
  • 12-inch skillet
  • instant-read thermometer
  • paper towels
  • slotted spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.