Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Tiradito: Seared Fish with Aji Amarillo

Silky raw fish kissed with heat, drowned in a bright yellow chili sauce and topped with crispy shallots. Peruvian elegance in under 15 minutes.

Total time
15 min
Servings
2
Calories
245
Protein
26g
Tiradito: Seared Fish with Aji Amarillo
elegantfreshperuvianfishsilkycrispydate-nightdinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Arrange fish slices on a cold plate, slightly overlapping. Season with a pinch of salt.

  2. Step 2

    Heat oil in a small skillet over medium-high. Add shallots and cook until golden and crispy, ~3 minutes.

  3. Step 3

    Whisk aji amarillo paste with lime juice and 1 tbsp water until smooth and pourable.

  4. Step 4

    Pour sauce evenly over the fish. Scatter crispy shallots and cilantro on top.

  5. Step 5

    Drizzle with 1 tbsp of the hot oil from the shallot pan. Serve immediately.

Tools you’ll need

  • cold plate
  • small skillet
  • whisk
  • slicing knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.