CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Creamy Tomato Soup with Gnocchi & Spinach

Warm, comforting tomato soup loaded with pillowy gnocchi and wilted spinach — dinner in under 15 minutes. Perfect for a cozy weeknight with zero fuss.

Total time
12 min
Servings
4
Calories
195
Protein
6g
Creamy Tomato Soup with Gnocchi & Spinach
comfortwholesomeitalianvegetariancreamytenderweeknightcozy

Ingredients

  • 2 cans (28 oz each) tomato soup (canned or carton)
  • 1 lb gnocchi (fresh or frozen)
  • 4 cups (loosely packed) fresh spinach

Instructions

  1. 1

    Pour tomato soup and 1 cup water into a pot, then bring to a steady simmer over medium-high heat.

  2. 2

    Add gnocchi and stir gently, cooking until they float and surface is tender, 3–4 minutes.

  3. 3

    Stir in spinach, a pinch of salt, and a grind of pepper, then cook until wilted, about 1 minute.

  4. 4

    Divide into bowls and serve hot.

Tools you’ll need

  • large pot
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.