Creamy Tomato Soup with Gnocchi & Spinach
Warm, comforting tomato soup loaded with pillowy gnocchi and wilted spinach — dinner in under 15 minutes. Perfect for a cozy weeknight with zero fuss.
- Total time
- 12 min
- Servings
- 4
- Calories
- 195
- Protein
- 6g

comfortwholesomeitalianvegetariancreamytenderweeknightcozy
Ingredients
- 2 cans (28 oz each) tomato soup (canned or carton)
- 1 lb gnocchi (fresh or frozen)
- 4 cups (loosely packed) fresh spinach
Instructions
- 1
Pour tomato soup and 1 cup water into a pot, then bring to a steady simmer over medium-high heat.
- 2
Add gnocchi and stir gently, cooking until they float and surface is tender, 3–4 minutes.
- 3
Stir in spinach, a pinch of salt, and a grind of pepper, then cook until wilted, about 1 minute.
- 4
Divide into bowls and serve hot.
Tools you’ll need
- large pot
- wooden spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



