Back to recipes
Creamy Tomato Soup with Gnocchi & Spinach
Warm, comforting tomato soup loaded with pillowy gnocchi and wilted spinach — dinner in under 15 minutes. Perfect for a cozy weeknight with zero fuss.
- Total time
- 12 min
- Servings
- 4
- Calories
- 195
- Protein
- 6g
comfortwholesomeitalianvegetariancreamytenderweeknightcozy
Ingredients
3 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Pour tomato soup and 1 cup water into a pot, then bring to a steady simmer over medium-high heat.
Step 2
Add gnocchi and stir gently, cooking until they float and surface is tender, 3–4 minutes.
Step 3
Stir in spinach, a pinch of salt, and a grind of pepper, then cook until wilted, about 1 minute.
Step 4
Divide into bowls and serve hot.
Tools you’ll need
- large pot
- wooden spoon
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
