Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Torta Salata with Greens and Cheese

A savory Italian vegetable tart with spinach, ricotta, and mozzarella baked in flaky pastry. Light enough for lunch, hearty enough for dinner.

Total time
45 min
Servings
4
Calories
380
Protein
14g
Torta Salata with Greens and Cheese
casualwholesomeitalianvegetariancheeseflakycreamyweeknight

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour and salt in a bowl. Cut in cold butter until mixture resembles breadcrumbs.

  2. Step 2

    Add ice water 1 tbsp at a time, stirring gently, until dough just comes together.

  3. Step 3

    Shape dough into a disk, wrap in plastic, and chill 15 minutes.

  4. Step 4

    Preheat oven to 400°F (200°C). Roll chilled dough to fit a 9-inch pie dish.

  5. Step 5

    Wilt spinach in a skillet over medium heat, 1–2 minutes. Squeeze out excess moisture.

  6. Step 6

    Mix ricotta, mozzarella, Pecoriano, egg, salt, and pepper in a bowl until combined.

  7. Step 7

    Fold cooled spinach into cheese mixture. Spread into pie crust evenly.

  8. Step 8

    Bake 25–30 minutes until crust is golden and filling is set. Cool 5 minutes.

  9. Step 9

    Slice into wedges and serve warm or room temperature.

Tools you’ll need

  • mixing bowl
  • 9-inch pie dish
  • rolling pin
  • 10-inch skillet
  • wooden spoon
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.