Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Tortang Talong

Crispy eggplant fritters with a savory tomato sauce — a beloved Filipino comfort dish. Pan-fried until golden and served with a simple egg coating that binds tender eggplant to a crunchy exterior.

Total time
25 min
Servings
2
Calories
320
Protein
10g
Tortang Talong
comfortwholesomefilipinovegetarianeggscrispytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice each eggplant lengthwise from stem to tip into two flat halves, each about 1/2 inch thick, so you have four paddle-shaped pieces total.

  2. Step 2

    Scoop out the flesh from each eggplant half with a spoon, leaving a 1/4-inch-thick skin shell intact — the hollowed centers will hold the filling later.

  3. Step 3

    Chop the scooped eggplant flesh into small pieces about the size of peas — you should have roughly 1 cup when finished.

  4. Step 4

    Crack both eggs into a shallow bowl and whisk with a fork until the whites and yolks are fully combined and no white streaks remain.

  5. Step 5

    Pour the 2 tablespoons flour into a separate shallow bowl.

  6. Step 6

    Heat 2 tablespoons olive oil in a large skillet over medium-high heat until the oil shimmers and slides quickly when you tilt the pan, about 90 seconds.

  7. Step 7

    Working with one eggplant half at a time, dip the skin side into the flour bowl to coat lightly, then dip into the whisked egg to coat both sides completely.

  8. Step 8

    Place the coated eggplant skin-side down into the hot oil — you should hear a steady sizzle immediately — and fry for 3 to 4 minutes until the egg coating turns golden brown and crispy.

  9. Step 9

    Flip the eggplant carefully with a spatula and fry the other side for 2 to 3 minutes until that side is also golden brown, then slide it onto a plate.

  10. Step 10

    Repeat steps 7 through 9 with the remaining three eggplant halves, adding 1 tablespoon oil to the skillet before the second batch if the pan looks dry.

  11. Step 11

    Pour 1 tablespoon olive oil into the same skillet and add the 2 minced garlic cloves, stirring constantly for 30 seconds until very fragrant.

  12. Step 12

    Pour in the 0.5 cup tomato sauce and stir until combined with the garlic oil, then simmer for 2 minutes over medium heat so the flavors blend.

  13. Step 13

    Arrange the fried eggplant halves on a serving plate, golden-side up, in a single layer.

  14. Step 14

    Spoon the warm tomato sauce over the center of each eggplant fritter so it pools on top.

Tools you’ll need

  • cutting board
  • chef's knife
  • spoon
  • two shallow bowls
  • fork for whisking
  • 12-inch skillet
  • wooden spoon
  • spatula
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.