Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Tortelli di Zucca — Butternut Pasta with Sage

Buttery roasted butternut ravioli with crispy sage and Parmigiano — restaurant-worthy in 25 minutes using wonton wrappers as a shortcut. Golden, nutty, one-pan finish.

Total time
25 min
Servings
2
Calories
485
Protein
18g
Tortelli di Zucca — Butternut Pasta with Sage
elegantsimpleitalianvegetarianvegetariantendercrispysilky

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix roasted butternut squash, 1/4 cup Parmigiano, salt, pepper, and nutmeg in a bowl until combined.

  2. Step 2

    Place 1 teaspoon filling in center of each wonton wrapper, wet edges with water, fold into half-moon, then press corners together.

  3. Step 3

    Bring a large pot of salted water to a boil; cook tortelli in batches until they float and then 2 minutes more, ~4 minutes total.

  4. Step 4

    While tortelli cook, melt butter in a large skillet over medium heat; add sage leaves and cook until edges curl and butter foams, ~3 minutes.

  5. Step 5

    Lift cooked tortelli from water with a slotted spoon and transfer directly into the sage butter; gently toss to coat.

  6. Step 6

    Divide onto plates, scatter remaining Parmigiano over top, and serve immediately while butter still sizzles.

Tools you’ll need

  • large mixing bowl
  • large pot
  • large skillet (12-inch)
  • slotted spoon
  • microplane or fine grater

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.