CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Vada Pav — Crispy Potato Fritters & Chutneys

Spiced potato fritters fried until golden, served with tangy green chutney, garlicky dry chutney, crispy fried chilies, and fresh red onion. A street-food favorite that tastes like Mumbai in your kitchen.

Total time
25 min
Servings
2
Calories
520
Protein
8g
Vada Pav — Crispy Potato Fritters & Chutneys
comfortcasualindianvegetarianvegetariancrispytenderweeknight

Ingredients

  • 2 whole potatoes, medium
  • ½ cup all-purpose flour
  • 1 tbsp ginger-garlic paste
  • 1 whole green chilies, finely minced
  • 2 cups neutral cooking oil for frying
  • ½ cup green chutney (store-bought)
  • ¼ cup dry garlic chutney (store-bought)

Instructions

  1. 1

    Boil potatoes until fork-tender, about 12 minutes. Drain, cool slightly, then peel and mash with salt and pepper.

  2. 2

    Fold flour, ginger-garlic paste, and minced green chili into the mashed potatoes until combined.

  3. 3

    Heat oil in a heavy-bottomed pot or deep skillet to 350°F (use a thermometer for accuracy).

  4. 4

    Shape potato mixture into 4 oval patties. Slide into hot oil and fry 3–4 minutes per side until deep golden brown.

  5. 5

    Drain vadas on paper towels. Arrange on a plate with green chutney, garlic chutney, fried green chilies, and sliced red onion alongside.

Tools you’ll need

  • pot for boiling
  • fork or potato masher
  • heavy-bottomed deep skillet or pot
  • deep-fry thermometer
  • slotted spoon
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.