Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Vada Pav — Crispy Potato Fritters & Chutneys

Spiced potato fritters fried until golden, served with tangy green chutney, garlicky dry chutney, crispy fried chilies, and fresh red onion. A street-food favorite that tastes like Mumbai in your kitchen.

Total time
25 min
Servings
2
Calories
520
Protein
8g
Vada Pav — Crispy Potato Fritters & Chutneys
comfortcasualindianvegetarianvegetariancrispytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil potatoes until fork-tender, about 12 minutes. Drain, cool slightly, then peel and mash with salt and pepper.

  2. Step 2

    Fold flour, ginger-garlic paste, and minced green chili into the mashed potatoes until combined.

  3. Step 3

    Heat oil in a heavy-bottomed pot or deep skillet to 350°F (use a thermometer for accuracy).

  4. Step 4

    Shape potato mixture into 4 oval patties. Slide into hot oil and fry 3–4 minutes per side until deep golden brown.

  5. Step 5

    Drain vadas on paper towels. Arrange on a plate with green chutney, garlic chutney, fried green chilies, and sliced red onion alongside.

Tools you’ll need

  • pot for boiling
  • fork or potato masher
  • heavy-bottomed deep skillet or pot
  • deep-fry thermometer
  • slotted spoon
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.