Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Vietnamese Chicken Noodle Salad

Chilled rice noodles tossed with shredded chicken, crisp vegetables, and a tangy lime-fish sauce dressing. Fresh herbs and peanuts add crunch and flavor—ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
385
Protein
28g
Vietnamese Chicken Noodle Salad
freshlightvietnamesechickencrispycrunchytenderSalad

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a large pot. Add rice noodles and cook until tender, ~7 minutes.

  2. Step 2

    Drain noodles and rinse under cold water until cool. Set aside in a large bowl.

  3. Step 3

    In a small bowl, whisk lime juice and fish sauce together until combined.

  4. Step 4

    Add chicken, cucumber, and carrots to the cooled noodles.

  5. Step 5

    Pour dressing over the salad and toss until evenly coated.

  6. Step 6

    Top with peanuts, mint, and cilantro. Serve cold or at room temperature.

Tools you’ll need

  • large pot
  • colander
  • large mixing bowl
  • small mixing bowl
  • whisk
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.