Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Vietnamese Lemongrass Shrimp with Rice Vermicelli

Charred shrimp tossed with fresh lemongrass, garlic, and chili over cool rice vermicelli and peanut sauce. Ready in 15 minutes — the kind of bright, garlicky dinner that feels like takeout but tastes homemade.

Total time
15 min
Servings
2
Calories
385
Protein
32g
Vietnamese Lemongrass Shrimp with Rice Vermicelli
freshquickvietnameseshrimpcrispytenderweeknightbowl

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a pot. Add rice vermicelli and cook 4 minutes until tender. Drain, rinse with cool water, and divide between two bowls.

  2. Step 2

    Heat 2 tbsp oil in a large skillet over high heat until shimmering, about 90 seconds.

  3. Step 3

    Add lemongrass, garlic, and chili. Cook 30 seconds, stirring constantly, until fragrant.

  4. Step 4

    Add shrimp and fish sauce. Stir constantly for 3–4 minutes until shrimp turn pink and edges begin to char.

  5. Step 5

    Divide shrimp and aromatics between the two bowls over the vermicelli.

  6. Step 6

    Drizzle peanut sauce over each bowl and serve immediately.

Tools you’ll need

  • large pot
  • 12-inch skillet
  • wooden spoon or spatula
  • knife and cutting board
  • two bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.