Back to recipes
Warm Feta with Honey & Cracked Pepper
Creamy baked feta with a golden honey drizzle and sharp black pepper bite — a Greek appetizer that feels fancy but takes 10 minutes. Serve with crusty bread or crackers for dipping.
- Total time
- 10 min
- Servings
- 2
- Calories
- 280
- Protein
- 6g
elegantsimplegreekvegetariancreamysoftsnackappetizer
Ingredients
4 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Heat oven to 375°F.
Step 2
Place feta block in a small baking dish and drizzle with olive oil.
Step 3
Bake feta until soft and warm, about 7 minutes.
Step 4
Drizzle honey over the feta and sprinkle with black pepper.
Step 5
Serve warm with bread or crackers for dipping.
Tools you’ll need
- oven
- small baking dish (6- to 8-inch)
- spoon
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
