Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Warm Pain au Chocolat with Coffee

Store-bought pain au chocolat warmed until crispy outside and melty inside, paired with strong French coffee. Pure indulgence in 10 minutes, no baking required.

Total time
10 min
Servings
2
Calories
320
Protein
6g
Warm Pain au Chocolat with Coffee
indulgentcozyfrenchvegetariancrispyflakymeltybreakfast

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 350°F.

  2. Step 2

    Place pain au chocolat on a baking sheet. Bake 6–8 minutes until the edges are golden and chocolate peeks through.

  3. Step 3

    Heat milk in a small saucepan over medium until steaming, about 2 minutes.

  4. Step 4

    Whisk in ground coffee and sugar. Strain through a fine-mesh sieve into two cups.

  5. Step 5

    Top each cup with butter and stir until melted. Serve immediately with warm pastries.

Tools you’ll need

  • oven
  • baking sheet
  • small saucepan
  • whisk
  • fine-mesh sieve
  • two mugs or cups

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.