Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Whisky Beef Tenderloin with Crispy Fries

Sear beef tenderloin until golden, then finish in a buttery whisky-cream sauce. Serve with crispy oven fries for a Spanish-inspired weeknight dinner that feels fancy but takes 20 minutes.

Total time
20 min
Servings
2
Calories
720
Protein
48g
Whisky Beef Tenderloin with Crispy Fries
indulgentelegantspanishbeeftendercrispyweeknightdate-night

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut potatoes into 1/4-inch fries, pat dry, toss with oil and salt, spread on a sheet pan, and bake at 425°F for 15 minutes.

  2. Step 2

    Pat beef steaks dry and season generously on both sides with salt and black pepper.

  3. Step 3

    Heat 1 tbsp oil in a heavy skillet over medium-high until shimmering, about 90 seconds.

  4. Step 4

    Sear steaks 90 seconds per side without moving. They should be golden brown and centers still medium-rare.

  5. Step 5

    Remove steaks to a plate. Add garlic to the pan and cook 30 seconds until fragrant, then pour in whisky and scrape up browned bits.

  6. Step 6

    Simmer whisky 1 minute to reduce slightly, then stir in cream and butter until melted and smooth.

  7. Step 7

    Return steaks to the pan, spoon sauce over them, and cook 30 seconds to warm through.

  8. Step 8

    Serve steaks with sauce and crispy fries on the side.

Tools you’ll need

  • sheet pan
  • heavy 12-inch skillet
  • knife and cutting board
  • paper towels
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.