Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Winter Melon Soup with Shrimp & Chicken

Delicate winter melon simmered in a savory broth with tender shrimp and chicken, finished with ginger and scallions. A light, restorative Chinese dinner that's naturally gluten-free.

Total time
45 min
Servings
4
Calories
185
Protein
28g
Winter Melon Soup with Shrimp & Chicken
wholesomelightchinesegluten-freeshrimpchickentendersilky

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Peel winter melon and remove seeds. Cut into 1-inch cubes; set aside.

  2. Step 2

    Cut chicken breast into 0.5-inch dice. Rinse shrimp under cold water.

  3. Step 3

    Bring stock to a boil in a large pot over high heat. Add ginger slices.

  4. Step 4

    Add diced chicken to boiling stock. Simmer 8 minutes until just cooked.

  5. Step 5

    Add winter melon cubes and shrimp. Simmer 4 minutes until shrimp turns opaque.

  6. Step 6

    Stir in soy sauce and sesame oil. Taste and adjust salt and white pepper.

  7. Step 7

    Transfer to bowls. Garnish with chopped scallions. Serve hot.

Tools you’ll need

  • large pot (4-quart minimum)
  • cutting board
  • chef's knife
  • wooden spoon
  • soup bowls
  • ladle

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.