Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

25-Minute Xinjiang Beef with Cumin & Chili

Tender beef strips wok-seared with celery and bell peppers, finished with toasted cumin and chili flakes for that signature Xinjiang heat and aroma. Serve over noodles or rice for a complete weeknight dinner.

Total time
25 min
Servings
2
Calories
420
Protein
38g
25-Minute Xinjiang Beef with Cumin & Chili
quicksatisfyingchinesebeefcrispytenderweeknightstir-fry

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Toast cumin seeds in a wok or large skillet over medium heat for 1 minute until fragrant, then transfer to a small bowl.

  2. Step 2

    Increase heat to high. Add 2 tbsp oil to the wok until it shimmers, about 30 seconds.

  3. Step 3

    Add beef in a single layer without stirring for 1 minute until the bottom caramelizes, then stir and cook until no pink remains, ~2 minutes total.

  4. Step 4

    Push beef to the side. Add remaining oil, then garlic, and stir for 20 seconds until fragrant.

  5. Step 5

    Add celery and peppers, tossing constantly for 2–3 minutes until vegetables are tender-crisp with charred edges.

  6. Step 6

    Pour in soy sauce, sprinkle the toasted cumin and chili flakes over everything, toss for 30 seconds, then serve immediately.

Tools you’ll need

  • 14-inch wok or large skillet
  • small bowl
  • tongs or wooden spoon
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.