Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Yunnan Er Kuai with Pork

Soft, chewy rice cakes topped with crispy pork, soy-vinegar sauce, and fresh herbs. A classic Yunnan street food that's quick and deeply satisfying.

Total time
25 min
Servings
4
Calories
385
Protein
16g
Yunnan Er Kuai with Pork
casualcomfortchineseporkchewycrispyweeknightmain-dish

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix soy sauce, vinegar, and chili oil in a small bowl. Set aside.

  2. Step 2

    Heat oil in a large skillet over medium-high until shimmering, ~90 seconds.

  3. Step 3

    Add diced pork and cook, stirring occasionally, until browned and cooked through, ~8 minutes.

  4. Step 4

    Add minced garlic and cook for 30 seconds until fragrant.

  5. Step 5

    Add er kuai cakes and toss gently until warmed through and slightly softened, ~3 minutes.

  6. Step 6

    Pour sauce over the top and toss to coat evenly for 1 minute.

  7. Step 7

    Divide into bowls and top with chopped scallions. Serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • small mixing bowl
  • spoon or spatula for tossing

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.