Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Zserbó: Apricot & Walnut Bars

Hungarian layered bar with buttery base, jammy apricot middle, and walnut topping — no mixer needed, all mixed by hand and baked in one pan.

Total time
25 min
Servings
6
Calories
385
Protein
6g
Zserbó: Apricot & Walnut Bars
cozyindulgenthungarianvegetariancrispychewyweeknightdessert

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 350°F. Line an 8×8 baking pan with parchment paper.

  2. Step 2

    Mix butter, sugar, and vanilla in a bowl until pale and fluffy, about 2 minutes by hand.

  3. Step 3

    Stir in flour and 0.5 cup walnuts until crumbly. Press half into the pan to form base.

  4. Step 4

    Spread jam evenly over crust. Whisk egg, then mix with remaining 0.5 cup walnuts and sugar.

  5. Step 5

    Dollop walnut mixture over jam and spread gently to cover. Bake until golden, 12–14 minutes.

  6. Step 6

    Cool in pan 5 minutes, then slice into 6 bars. Serve warm or at room temperature.

Tools you’ll need

  • 8×8 baking pan
  • parchment paper
  • mixing bowl
  • whisk
  • wooden spoon
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.