Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

10-Minute Garlic Marinara

A silky tomato sauce built on three ingredients—canned tomatoes, garlic, and basil—that comes together in under 10 minutes. Toss with hot pasta, or use as a base for pizza, dipping, or soups.

Total time
10 min
Servings
6
Calories
125
Protein
2g
10-Minute Garlic Marinara
simplequickitalianvegetarianvegandairy-freesmoothsilky

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat olive oil in a medium saucepan over medium heat for 60 seconds until shimmering.

  2. Step 2

    Add minced garlic and cook for 30–45 seconds, stirring constantly, until fragrant but not brown.

  3. Step 3

    Pour in canned tomatoes with their juice, breaking up whole tomatoes with the back of a spoon.

  4. Step 4

    Simmer uncovered for 6–8 minutes, stirring occasionally, until sauce thickens slightly.

  5. Step 5

    Stir in fresh basil, then taste and season with salt and pepper to your preference.

  6. Step 6

    Serve hot over pasta, or use as a dip, pizza base, or soup ingredient.

Tools you’ll need

  • medium saucepan
  • wooden spoon or silicone spatula
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.