Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Onigiri Rice Balls

Warm sushi rice shaped into triangles with crispy nori, umeboshi, and sesame. A Japanese lunchbox staple that's faster than delivery and twice as satisfying.

Total time
15 min
Servings
2
Calories
210
Protein
4g
15-Min Onigiri Rice Balls
simplewholesomejapanesevegetarianvegancrispytenderweeknight

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Wet your hands with water and sprinkle salt on your palms to prevent sticking.

  2. Step 2

    Scoop 1/2 cup warm rice into your palm, flatten it slightly, and press umeboshi or a pinch of furikake into the center.

  3. Step 3

    Cover with another 1/4 cup rice and gently shape into a triangle, compressing until firm but not dense.

  4. Step 4

    Wrap the nori strip around the base. Repeat with remaining rice to make 4 onigiri total.

  5. Step 5

    Sprinkle sesame seeds over the top of each onigiri.

  6. Step 6

    Serve immediately or wrap individually in plastic wrap for lunch.

Tools you’ll need

  • shallow bowl for water
  • hands (primary tool)
  • cutting board (optional, for assembly)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.