Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Gujarati Thali

A vibrant vegetarian feast built on fluffy rice with crispy okra, buttery dal, and zingy cucumber raita. Comes together on one skillet in 20 minutes—pure comfort, no fuss.

Total time
20 min
Servings
2
Calories
385
Protein
14g
Gujarati Thali
comfortwholesomeindianvegetariandairy-freelentilscrispytender

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a large skillet over medium-high. When it shimmers, add mustard seeds and listen for them to pop, ~30 seconds.

  2. Step 2

    Stir in ginger-garlic paste, cook until fragrant, ~30 seconds. Add okra, cook without stirring for 2 minutes until edges brown.

  3. Step 3

    Toss okra, sprinkle salt and chili powder, cook 2 more minutes until crispy and golden. Transfer to a plate.

  4. Step 4

    In the same skillet, warm the dal with a splash of water, stirring occasionally, 2 minutes. Season with salt and pepper.

  5. Step 5

    In a small bowl, toss cucumber with tomato, a pinch of salt, and a squeeze of lemon. Let sit 1 minute.

  6. Step 6

    Divide rice between two plates. Top with warm dal, crispy okra, and cucumber-tomato raita. Serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • small bowl
  • spoon
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.