Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Thepla, Pithla & Thecha — Gujarati Spiced Plate

Crispy fenugreek flatbreads, garlicky chickpea curry, spicy cilantro chutney, and onion on one plate. A complete Gujarati dinner that tastes homemade in under 20 minutes.

Total time
18 min
Servings
2
Calories
425
Protein
14g
Thepla, Pithla & Thecha — Gujarati Spiced Plate
comfortwholesomeindianvegetarianveganchickpeascrispysoft

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix whole wheat flour, methi, 0.25 tsp turmeric, 0.5 tsp salt, and a pinch of cayenne pepper in a bowl.

  2. Step 2

    Add water 2 tbsp at a time, kneading until soft and pliable, about 3 minutes. Let rest 2 minutes.

  3. Step 3

    For pithla: Heat 1 tbsp oil in a skillet, add chickpea flour, cook 1 minute, then add 0.75 cup water and simmer 4 minutes until thickened.

  4. Step 4

    For thecha: Grind cilantro, green chili, garlic, salt, and 1 tbsp oil into a coarse paste; set aside.

  5. Step 5

    Divide dough into 4 balls, roll each into a thin round, and pan-fry in dry skillet 60 seconds per side until crispy and spotty.

  6. Step 6

    Plate thepla, top with warm pithla, dollop thecha on the side, and scatter raw onion over top. Serve immediately.

Tools you’ll need

  • medium mixing bowl
  • 12-inch nonstick skillet or cast iron
  • mortar and pestle or food processor
  • measuring cups and spoons
  • rolling pin and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.