Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

5-Min Berry Pavlova Nests

No-bake pavlova shells with whipped cream and fresh berries—ready in minutes. Crispy meringue nests that feel fancy but require zero baking.

Total time
5 min
Servings
4
Calories
245
Protein
2g
5-Min Berry Pavlova Nests
elegantsimplefrenchvegetariancrispycreamyfluffydate-night

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pour heavy cream into a bowl. Whip with a mixer or by hand until soft peaks form, about 2 minutes.

  2. Step 2

    Fold in powdered sugar and vanilla extract until the cream is fluffy and smooth.

  3. Step 3

    Hull and halve the strawberries. Leave blueberries whole.

  4. Step 4

    Spoon whipped cream into each meringue nest, filling generously.

  5. Step 5

    Top each nest with strawberry halves and blueberries, pressing gently into the cream.

  6. Step 6

    Serve immediately or chill up to 2 hours.

Tools you’ll need

  • mixing bowl
  • electric mixer or whisk
  • chef's knife
  • cutting board
  • small spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.