Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Spring Rolls

Rice paper wraps filled with shredded cabbage, carrots, and fresh herbs, then pan-fried until golden and crispy. Serve with a tangy dipping sauce for a restaurant-quality appetizer or light dinner.

Total time
20 min
Servings
2
Calories
145
Protein
2g
Crispy Spring Rolls
freshcasualvietnamesevegetariandairy-freecrispytenderBread

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk fish sauce, lime juice, sugar, and 3 tbsp water until sugar dissolves.

  2. Step 2

    Dip one rice paper in warm water for 5 seconds until pliable, then place flat on a clean surface.

  3. Step 3

    Layer cabbage, carrot, and herbs in the center third of the wrapper, leaving 2 inches at both ends.

  4. Step 4

    Fold the bottom third up, tuck in the sides, then roll tightly away from you until sealed.

  5. Step 5

    Repeat steps 2–4 with remaining wrappers. Heat oil in a 10-inch skillet over medium-high until shimmering.

  6. Step 6

    Working in batches, fry rolls 2 minutes per side until golden and crispy, then transfer to a plate.

  7. Step 7

    Serve hot with the dipping sauce on the side.

Tools you’ll need

  • shallow bowl or pie dish
  • cutting board
  • 10-inch nonstick skillet
  • wooden spoon or tongs
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.