Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Pan Spring Rolls

Chewy rice paper wraps stuffed with shrimp, cabbage, and herbs, then pan-fried until golden and served with tangy dipping sauce. Ready in 18 minutes.

Total time
18 min
Servings
2
Calories
245
Protein
18g
Crispy Pan Spring Rolls
casualfreshvietnameseshrimpcrispychewytenderBread

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat shrimp dry and season with salt and pepper. Heat oil in a skillet over medium-high until shimmering.

  2. Step 2

    Cook shrimp 90 seconds per side until pink and opaque. Transfer to a plate and chop roughly.

  3. Step 3

    Dip rice paper into a bowl of warm water for 15 seconds until pliable. Lay on a work surface.

  4. Step 4

    Fill each wrapper with cabbage, herbs, and a few shrimp pieces. Fold sides inward, then roll tightly.

  5. Step 5

    Pan-fry rolls seam-side down in the same skillet over medium-high until golden, 2–3 minutes per side.

  6. Step 6

    Mix hoisin, sriracha, and a squeeze of lime juice. Serve rolls hot with the dipping sauce.

Tools you’ll need

  • 12-inch skillet
  • shallow bowl or wide dish
  • cutting board
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.