Back to recipes
5-Minute Boba Tea
Chewy tapioca pearls, sweet milk tea, and ice in a glass — the viral TikTok favorite you can make at home in minutes. No special equipment needed, just tea, milk, and a straw.
- Total time
- 5 min
- Servings
- 1
- Calories
- 185
- Protein
- 2g
refreshingcasualtaiwanesevegetarianchewycreamysnacksummer
Ingredients
5 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Pour cooled tea into a tall glass. Stir in sugar until dissolved.
Step 2
Add tapioca pearls to the bottom of the glass, then pour in milk.
Step 3
Fill the glass with ice and stir gently to combine.
Step 4
Insert a wide boba straw and serve immediately.
Tools you’ll need
- tall drinking glass (12-16 oz)
- wide boba straw
- spoon or straw for stirring
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
