CookSnap is in beta — Get it free on TestFlight →
Back to recipes

5-Minute Boba Tea

Chewy tapioca pearls, sweet milk tea, and ice in a glass — the viral TikTok favorite you can make at home in minutes. No special equipment needed, just tea, milk, and a straw.

Total time
5 min
Servings
1
Calories
185
Protein
2g
5-Minute Boba Tea
refreshingcasualtaiwanesevegetarianchewycreamysnacksummer

Ingredients

  • ¾ cup brewed black tea, cooled
  • ¼ cup whole milk or condensed milk
  • ¼ cup cooked tapioca pearls
  • 1 tbsp granulated sugar
  • ½ cup ice cubes

Instructions

  1. 1

    Pour cooled tea into a tall glass. Stir in sugar until dissolved.

  2. 2

    Add tapioca pearls to the bottom of the glass, then pour in milk.

  3. 3

    Fill the glass with ice and stir gently to combine.

  4. 4

    Insert a wide boba straw and serve immediately.

Tools you’ll need

  • tall drinking glass (12-16 oz)
  • wide boba straw
  • spoon or straw for stirring

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.