CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Classic Tapioca Bubble Tea

Chewy tapioca pearls, sweet milk tea, and ice in one iconic Taiwanese drink. Mix, chill, sip—ready in under 10 minutes.

Total time
8 min
Servings
1
Calories
238
Protein
4g
Classic Tapioca Bubble Tea
refreshingcasualtaiwanesevegetarianchewycreamysnacksummer

Ingredients

  • ¼ cup cooked tapioca pearls
  • ¾ cup strong brewed black tea, cooled
  • ½ cup whole milk
  • 2 tbsp sweetened condensed milk
  • ½ cup ice cubes
  • 1 piece boba straw (wide straws for pearls)

Instructions

  1. 1

    Pour cooled tea into a tall glass. Add condensed milk and stir until fully dissolved and color turns caramel.

  2. 2

    Pour in whole milk and stir gently to combine. The drink should look pale brown and creamy.

  3. 3

    Add ice cubes to fill the glass about three-quarters full. Stir briefly to chill.

  4. 4

    Spoon cooked tapioca pearls into the glass, then drop in the boba straw and serve immediately.

Tools you’ll need

  • tall glass (12–16 oz)
  • boba straw (wide, for tapioca pearls)
  • spoon for stirring and scooping

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.