Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Classic Tapioca Bubble Tea

Chewy tapioca pearls, sweet milk tea, and ice in one iconic Taiwanese drink. Mix, chill, sip—ready in under 10 minutes.

Total time
8 min
Servings
1
Calories
238
Protein
4g
Classic Tapioca Bubble Tea
refreshingcasualtaiwanesevegetarianchewycreamysnacksummer

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pour cooled tea into a tall glass. Add condensed milk and stir until fully dissolved and color turns caramel.

  2. Step 2

    Pour in whole milk and stir gently to combine. The drink should look pale brown and creamy.

  3. Step 3

    Add ice cubes to fill the glass about three-quarters full. Stir briefly to chill.

  4. Step 4

    Spoon cooked tapioca pearls into the glass, then drop in the boba straw and serve immediately.

Tools you’ll need

  • tall glass (12–16 oz)
  • boba straw (wide, for tapioca pearls)
  • spoon for stirring and scooping

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.