CookSnap is in beta — Get it free on TestFlight →
Back to recipes

20-Min Alfredo Chicken Basil Pizza

Store-bought pizza dough topped with creamy alfredo sauce, warm roasted chicken, and fresh basil — a weeknight pizza that tastes like it came from a wood-fired oven. Ready in 20 minutes, no fuss.

Total time
20 min
Servings
2
Calories
580
Protein
32g
20-Min Alfredo Chicken Basil Pizza
comfortsimpleitalianchickencrispycreamytenderweeknight

Ingredients

  • 1 lb (room temperature) pizza dough
  • ¾ cup alfredo sauce
  • 1 cup (shredded or cubed) roasted chicken
  • ¼ cup (loosely packed, torn) fresh basil

Instructions

  1. 1

    Preheat the oven to 475°F and lightly oil a large baking sheet.

  2. 2

    Stretch the dough into a thin oval, then lay it on the sheet.

  3. 3

    Spread alfredo sauce evenly over the dough, leaving a 0.5-inch border.

  4. 4

    Scatter the roasted chicken across the sauce.

  5. 5

    Bake until the crust is golden and crispy, about 10–12 minutes.

  6. 6

    Remove from the oven and scatter fresh basil over the top.

Tools you’ll need

  • oven
  • large baking sheet
  • spoon or spatula for spreading

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.