Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Alfredo Chicken Basil Pizza

Store-bought pizza dough topped with creamy alfredo sauce, warm roasted chicken, and fresh basil — a weeknight pizza that tastes like it came from a wood-fired oven. Ready in 20 minutes, no fuss.

Total time
20 min
Servings
2
Calories
580
Protein
32g
20-Min Alfredo Chicken Basil Pizza
comfortsimpleitalianchickencrispycreamytenderweeknight

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat the oven to 475°F and lightly oil a large baking sheet.

  2. Step 2

    Stretch the dough into a thin oval, then lay it on the sheet.

  3. Step 3

    Spread alfredo sauce evenly over the dough, leaving a 0.5-inch border.

  4. Step 4

    Scatter the roasted chicken across the sauce.

  5. Step 5

    Bake until the crust is golden and crispy, about 10–12 minutes.

  6. Step 6

    Remove from the oven and scatter fresh basil over the top.

Tools you’ll need

  • oven
  • large baking sheet
  • spoon or spatula for spreading

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.