Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Almond Croissants

Buttery, flaky croissants filled with almond cream and topped with sliced almonds and a light glaze. These French pastries require laminated dough but reward with restaurant-quality results.

Total time
55 min
Servings
4
Calories
385
Protein
8g
Almond Croissants
indulgentelegantfrenchvegetarianflakycrispytenderweekend

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Beat softened butter and sugar until pale and fluffy, about 2 minutes.

  2. Step 2

    Fold in almond flour and half egg until smooth.

  3. Step 3

    Preheat oven to 400°F (200°C). Line a large baking sheet with parchment paper.

  4. Step 4

    Unroll croissant dough and separate into individual croissants (or triangles if using a sheet).

  5. Step 5

    Spread 1 tbsp almond filling on the wider base of each croissant triangle.

  6. Step 6

    Roll from the base toward the point, then curve into a crescent shape.

  7. Step 7

    Place croissants point-side down on the baking sheet, leaving 2 inches between each.

  8. Step 8

    Whisk egg yolk with 1 tbsp water. Brush each croissant with egg wash.

  9. Step 9

    Press sliced almonds onto the tops, then bake until golden brown, 18–20 minutes.

  10. Step 10

    Heat jam with 1 tbsp water in a small saucepan until loose, about 1 minute.

  11. Step 11

    Brush warm glaze over hot croissants immediately after removing from oven.

  12. Step 12

    Cool on the baking sheet for 5 minutes, then transfer to a wire rack.

Tools you’ll need

  • electric mixer or whisk
  • mixing bowls (2)
  • baking sheet
  • parchment paper
  • small saucepan
  • pastry brush
  • wire rack

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.