Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

25-Min Crispy Butter Croissant Bake

Laminated croissant dough meets caramelized butter and fleur de sel in a sheet-pan finish that rivals the bakery. Golden, flaky layers crack under your fork with zero yeast-wait stress.

Total time
25 min
Servings
4
Calories
365
Protein
6g
25-Min Crispy Butter Croissant Bake
indulgentelegantfrenchvegetariancrispyflakybutteryweekend

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Line a sheet pan with parchment. Thaw croissant dough slightly, ~5 min, until pliable but still cold.

  2. Step 2

    Cut each thawed croissant sheet into 4 triangles (or use pre-cut croissants). Arrange on the sheet pan, spacing 2 inches apart.

  3. Step 3

    Whisk egg yolk + milk + vanilla in a small bowl until glossy. Brush over croissant tops, then sprinkle turbinado sugar evenly.

  4. Step 4

    Bake 15–18 minutes until deep golden brown and crispy. Edges should look caramelized and smell buttery.

  5. Step 5

    While croissants bake, melt butter in a small saucepan over medium heat. Cook 3–4 min until it foams and turns amber; swirl in honey.

  6. Step 6

    Remove croissants from oven. Brush warm honey-butter over the tops immediately, then finish with a pinch of fleur de sel. Serve hot.

Tools you’ll need

  • sheet pan
  • parchment paper
  • small bowl
  • whisk
  • pastry brush
  • small saucepan
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.