Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Arepa Reina Pepiada

Crispy golden arepas stuffed with a creamy chicken and avocado filling—Venezuela's beloved street food. Ready in under 30 minutes with simple ingredients.

Total time
28 min
Servings
2
Calories
612
Protein
38g
Arepa Reina Pepiada
comfortcasualvenezuelanchickencrispycreamytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pour 1 cup of arepa flour into a large mixing bowl, then add 0.75 cup of warm water and 1 pinch of salt.

  2. Step 2

    Mix with a wooden spoon, stirring in one direction for 1 minute, until the dough is smooth and feels like soft Play-Doh with no lumps or dry flour visible.

  3. Step 3

    Let the dough rest in the bowl, uncovered, for 5 minutes so the flour absorbs the water completely.

  4. Step 4

    Cut the avocado lengthwise around the pit, twist the two halves apart, scoop out the pit, and use a spoon to scoop the flesh into a medium bowl.

  5. Step 5

    Add 1.5 cups of shredded chicken and 0.25 cup of mayonnaise to the avocado, then mash everything together with a fork until chunky-creamy, about 30 seconds.

  6. Step 6

    Taste the filling and sprinkle in salt and pepper until it tastes savory and bright.

  7. Step 7

    Divide the dough into 4 equal portions, then roll each one between your palms into a ball about the size of a golf ball.

  8. Step 8

    Flatten each ball into a thick disk about 3 inches wide and 0.5 inches thick by pressing it between the heels of your hands.

  9. Step 9

    Pour 0.25 inch of neutral oil into a 10-inch skillet and heat over medium-high heat until the oil shimmers and moves quickly when you tilt the pan, about 90 seconds.

  10. Step 10

    Slide 2 arepa disks into the hot oil and fry for 3 minutes until the bottom surface turns golden honey-brown, then flip and fry the other side for 3 minutes until equally brown.

  11. Step 11

    Remove the cooked arepas to a paper towel-lined plate using a slotted spatula, then repeat with the remaining 2 disks in the same oil.

  12. Step 12

    Once all arepas are cool enough to hold, use a small sharp knife to slice each one horizontally about 1 inch from the top, cutting parallel to the board, creating a small pocket.

  13. Step 13

    Spoon 2 tablespoons of the chicken-avocado filling into the pocket of each arepa, dividing the filling evenly among the 4 arepas, and serve immediately.

Tools you’ll need

  • large mixing bowl
  • wooden spoon
  • medium mixing bowl
  • fork
  • 10-inch skillet
  • paper towels
  • slotted spatula
  • small sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.