Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Arepa Rellena with Shredded Chicken & Cheese

Golden-fried corn patties stuffed with shredded chicken, melted cheese, and a bright lime crema. Ready in 25 minutes—the TikTok-friendly version of Colombia's iconic street snack.

Total time
25 min
Servings
2
Calories
580
Protein
24g
Crispy Arepa Rellena with Shredded Chicken & Cheese
casualcomfortcolombianchickencrispycreamytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix arepa flour, warm water, and a pinch of salt until a soft dough forms, about 1 minute.

  2. Step 2

    Stir lime juice and a pinch of salt into sour cream; set the crema aside.

  3. Step 3

    Form 4 golf-ball-sized dough balls and flatten to thick discs. Make a pocket in each and fill with chicken and cheese.

  4. Step 4

    Heat oil in a deep skillet over medium-high until shimmering. Fry arepas 3 minutes per side until deep golden.

  5. Step 5

    Transfer arepas to a paper towel–lined plate. Serve hot with lime crema on the side.

Tools you’ll need

  • large mixing bowl
  • deep skillet (10-inch minimum)
  • kitchen scale or measuring cups
  • slotted spoon
  • paper towels
  • small bowl for crema

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.