Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Asam Laksa with Shrimp

Tangy, aromatic Malaysian fish soup with shrimp and rice noodles. Built on tamarind paste and laksa paste for authentic flavor in under 20 minutes.

Total time
20 min
Servings
2
Calories
280
Protein
22g
Asam Laksa with Shrimp
freshboldmalaysianshrimptendersilkyweeknightdinner

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring stock to a boil in a large pot over medium-high heat, about 3 minutes.

  2. Step 2

    Stir in laksa paste and tamarind paste until smooth. Simmer 2 minutes to bloom flavors.

  3. Step 3

    Add shrimp. Simmer until opaque and cooked through, 3–4 minutes. Don't overcook.

  4. Step 4

    While shrimp cooks, soak rice noodles in hot water until softened, about 4 minutes. Drain.

  5. Step 5

    Squeeze lime juice into the broth. Taste and adjust salt and spice as needed.

  6. Step 6

    Divide noodles into bowls. Ladle broth and shrimp over top. Garnish with cilantro and chili.

Tools you’ll need

  • large pot (4–5 quart)
  • wooden spoon
  • bowls
  • ladle

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.