Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Quick Assam Laksa with Shrimp

A tangy, aromatic noodle soup built on store-bought laksa paste and coconut milk, finished with fresh shrimp in under 25 minutes. Bold tamarind flavor balanced with creamy richness.

Total time
25 min
Servings
2
Calories
420
Protein
16g
Quick Assam Laksa with Shrimp
comfortboldmalaysianshrimptendersilkyweeknightsoup

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pour 2 cups of fish stock into a 4-quart pot and set it over medium-high heat; wait until you see steam rising and small bubbles forming at the bottom, about 4 minutes.

  2. Step 2

    Add 3 tablespoons of laksa paste to the hot stock, stirring with a wooden spoon until no lumps remain and the paste dissolves into the broth, about 1 minute.

  3. Step 3

    Pour in the full can of coconut milk, stirring constantly until the mixture looks uniform and creamy with no visible white streaks, about 2 minutes.

  4. Step 4

    Add the 8 ounces of shrimp to the simmering broth, stirring occasionally, and cook until they turn opaque pink from tail to head, about 3 minutes.

  5. Step 5

    Add the 6 ounces of rice noodles directly to the pot and stir gently to separate them; cook until they are tender when bitten but still have a slight resistance, about 4 minutes.

  6. Step 6

    Squeeze the juice from the lime halves into the pot and stir once to combine, about 15 seconds.

  7. Step 7

    Pour the soup into two bowls, dividing the noodles and shrimp equally, and serve immediately while steaming hot.

Tools you’ll need

  • 4-quart pot with lid
  • wooden spoon
  • measuring spoons
  • measuring cups
  • two serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.