CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Quick Assam Laksa with Shrimp

A tangy, aromatic noodle soup built on store-bought laksa paste and coconut milk, finished with fresh shrimp in under 25 minutes. Bold tamarind flavor balanced with creamy richness.

Total time
25 min
Servings
2
Calories
420
Protein
16g
Quick Assam Laksa with Shrimp
comfortboldmalaysianshrimptendersilkyweeknightsoup

Ingredients

  • 3 tablespoons Laksa paste (Malaysian, such as Tean's or AROY)
  • 1 can (13.5 oz) Coconut milk, full-fat
  • 2 cups Fish stock or water
  • 8 oz Large shrimp, peeled and deveined
  • 6 oz Fresh rice noodles or ramen noodles
  • 1 whole Lime, halved

Instructions

  1. 1

    Pour 2 cups of fish stock into a 4-quart pot and set it over medium-high heat; wait until you see steam rising and small bubbles forming at the bottom, about 4 minutes.

  2. 2

    Add 3 tablespoons of laksa paste to the hot stock, stirring with a wooden spoon until no lumps remain and the paste dissolves into the broth, about 1 minute.

  3. 3

    Pour in the full can of coconut milk, stirring constantly until the mixture looks uniform and creamy with no visible white streaks, about 2 minutes.

  4. 4

    Add the 8 ounces of shrimp to the simmering broth, stirring occasionally, and cook until they turn opaque pink from tail to head, about 3 minutes.

  5. 5

    Add the 6 ounces of rice noodles directly to the pot and stir gently to separate them; cook until they are tender when bitten but still have a slight resistance, about 4 minutes.

  6. 6

    Squeeze the juice from the lime halves into the pot and stir once to combine, about 15 seconds.

  7. 7

    Pour the soup into two bowls, dividing the noodles and shrimp equally, and serve immediately while steaming hot.

Tools you’ll need

  • 4-quart pot with lid
  • wooden spoon
  • measuring spoons
  • measuring cups
  • two serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.