Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Bacalao con Tomate

Flaky salt-cod fillets seared golden, then finished in a bright tomato sauce with garlic and a whisper of paprika. Spanish comfort in one skillet, ready in 20 minutes.

Total time
20 min
Servings
2
Calories
312
Protein
38g
20-Min Bacalao con Tomate
rusticsimplespanishfishflakytenderweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat cod fillets dry with paper towels. Season lightly with salt and black pepper on both sides.

  2. Step 2

    Heat olive oil in a large skillet over medium-high until shimmering, about 90 seconds.

  3. Step 3

    Sear cod skin-side down for 3 minutes without moving until skin is golden and crispy.

  4. Step 4

    Flip cod carefully. Add minced garlic to the pan around the fillets and cook 30 seconds until fragrant.

  5. Step 5

    Pour crushed tomatoes over cod, sprinkle paprika, and simmer gently for 6 minutes until sauce thickens.

  6. Step 6

    Squeeze lemon juice over the top and serve straight from the skillet.

Tools you’ll need

  • 12-inch skillet (cast iron or nonstick)
  • paper towels
  • wooden spoon
  • lemon juicer (optional)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.