Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Bacalao con Tomate — Spanish Cod with Tomato Rice

Pan-seared cod over tomato rice with roasted cherry tomatoes in one sheet pan, ready in under 20 minutes. Bright, garlicky, and authentically Spanish.

Total time
18 min
Servings
2
Calories
385
Protein
32g
Bacalao con Tomate — Spanish Cod with Tomato Rice
freshcasualspanishfishflakytenderweeknightdinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp olive oil in a large skillet over medium-high. Add garlic, cook 30 seconds until fragrant.

  2. Step 2

    Add rice, stir to coat, then pour in canned tomatoes with their juice and 1.25 cups water.

  3. Step 3

    Bring to a boil, then reduce heat to low, cover, and simmer for 12 minutes until rice is almost tender.

  4. Step 4

    Arrange halved cherry tomatoes on top of rice. Pat cod dry, season with salt and pepper, then lay on top.

  5. Step 5

    Drizzle cod with remaining 1 tbsp olive oil. Cover and cook 6–7 minutes until fish flakes easily at thickest point.

  6. Step 6

    Serve immediately in shallow bowls, spooning tomato rice and roasted cherry tomatoes alongside the cod.

Tools you’ll need

  • 12-inch skillet with lid
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.