CookSnap is in beta — Get it free on TestFlight →
Back to recipes

15-Min Crispy Tuna Empanadas

Golden, flaky pastry pockets stuffed with Spanish-style tuna, peppers, and onions—ready in under 15 minutes with store-bought empanada wrappers. A TikTok-easy dinner that tastes like you spent hours.

Total time
15 min
Servings
2
Calories
312
Protein
16g
15-Min Crispy Tuna Empanadas
casualsatisfyingspanishfishcrispytenderflakyweeknight

Ingredients

  • 1 can (5 oz), drained canned tuna in oil
  • ½ medium red bell pepper, diced
  • ¼ medium yellow onion, diced
  • 3 tbsp pitted green olives, chopped
  • 2 whole roasted red piquillo peppers, chopped
  • 8 wrappers empanada wrappers
  • 2 tbsp neutral cooking oil

Instructions

  1. 1

    Mix tuna, diced pepper, onion, olives, and piquillo peppers in a bowl.

  2. 2

    Place 2 tbsp filling in the center of each empanada wrapper, fold in half, and press edges to seal.

  3. 3

    Heat oil in a large skillet over medium-high until shimmering, about 1 minute.

  4. 4

    Fry empanadas 2 minutes per side until edges turn golden brown and crispy.

  5. 5

    Transfer to a paper towel and let cool 1 minute before serving.

Tools you’ll need

  • medium mixing bowl
  • large skillet (10-inch minimum)
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.