Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Crispy Tuna Empanadas

Golden, flaky pastry pockets stuffed with Spanish-style tuna, peppers, and onions—ready in under 15 minutes with store-bought empanada wrappers. A TikTok-easy dinner that tastes like you spent hours.

Total time
15 min
Servings
2
Calories
312
Protein
16g
15-Min Crispy Tuna Empanadas
casualsatisfyingspanishfishcrispytenderflakyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix tuna, diced pepper, onion, olives, and piquillo peppers in a bowl.

  2. Step 2

    Place 2 tbsp filling in the center of each empanada wrapper, fold in half, and press edges to seal.

  3. Step 3

    Heat oil in a large skillet over medium-high until shimmering, about 1 minute.

  4. Step 4

    Fry empanadas 2 minutes per side until edges turn golden brown and crispy.

  5. Step 5

    Transfer to a paper towel and let cool 1 minute before serving.

Tools you’ll need

  • medium mixing bowl
  • large skillet (10-inch minimum)
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.