Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Baked Cheese & Spinach Burek

Crispy phyllo pastry layered with spinach, feta, and eggs—a Balkan classic made on a sheet pan. Golden, flaky, and ready in under an hour.

Total time
50 min
Servings
4
Calories
385
Protein
16g
Baked Cheese & Spinach Burek
comfortrusticbalkanvegetarianeggscheesecrispyflaky

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 375°F. Line a 9x13-inch baking sheet with parchment paper.

  2. Step 2

    Mix thawed spinach, crumbled feta, 2 beaten eggs, salt, and pepper in a bowl until combined.

  3. Step 3

    Whisk remaining egg in a small bowl with 1 tbsp water to make an egg wash.

  4. Step 4

    Brush one phyllo sheet with melted butter; place on baking sheet.

  5. Step 5

    Repeat with 3 more phyllo sheets, brushing each with butter, stacking as you go.

  6. Step 6

    Spread spinach-feta mixture evenly over phyllo stack.

  7. Step 7

    Layer remaining 4 phyllo sheets on top, brushing each with butter between layers.

  8. Step 8

    Brush top phyllo sheet with egg wash until glossy.

  9. Step 9

    Bake until phyllo is deep golden brown and crispy, 25–30 minutes.

  10. Step 10

    Cool for 5 minutes. Cut into squares and serve warm.

Tools you’ll need

  • 9x13-inch baking sheet
  • parchment paper
  • mixing bowl
  • whisk
  • small bowl
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.