CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Bangsilog — Crispy Milkfish, Rice & Egg

Filipino breakfast staple: pan-fried milkfish fillet with crispy edges, served with jasmine rice, soft-boiled egg, and cool cucumber slices. Ready in 20 minutes.

Total time
20 min
Servings
2
Calories
520
Protein
32g
Bangsilog — Crispy Milkfish, Rice & Egg
comfortsatisfyingfilipinofishcrispytenderflakyweeknight

Ingredients

  • 2 fillets (about 6 oz total) milkfish fillets (bangus), skin on
  • 1.5 cups cooked jasmine rice
  • 2 whole eggs
  • 1 whole cucumber
  • 2 tbsp olive oil
  • 1 pinch salt and black pepper

Instructions

  1. 1

    Boil water in a small pot, then gently add eggs and cook 7 minutes for soft-boiled yolks.

  2. 2

    Pat milkfish fillets dry with paper towels. Season both sides with salt and pepper.

  3. 3

    Heat oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  4. 4

    Lay milkfish skin-side down in the skillet. Cook 4–5 minutes without moving until skin is crispy and golden.

  5. 5

    Flip fillets and cook 2 minutes more until flesh is opaque and flakes easily.

  6. 6

    Warm rice in the skillet alongside the fish for 1 minute, then plate with sliced cucumber, peeled egg, and a squeeze of lime if available.

Tools you’ll need

  • small pot
  • large skillet (12-inch or wider)
  • paper towels
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.