Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Bangsilog — Crispy Milkfish, Rice & Egg

Filipino breakfast staple: pan-fried milkfish fillet with crispy edges, served with jasmine rice, soft-boiled egg, and cool cucumber slices. Ready in 20 minutes.

Total time
20 min
Servings
2
Calories
520
Protein
32g
Bangsilog — Crispy Milkfish, Rice & Egg
comfortsatisfyingfilipinofishcrispytenderflakyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil water in a small pot, then gently add eggs and cook 7 minutes for soft-boiled yolks.

  2. Step 2

    Pat milkfish fillets dry with paper towels. Season both sides with salt and pepper.

  3. Step 3

    Heat oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  4. Step 4

    Lay milkfish skin-side down in the skillet. Cook 4–5 minutes without moving until skin is crispy and golden.

  5. Step 5

    Flip fillets and cook 2 minutes more until flesh is opaque and flakes easily.

  6. Step 6

    Warm rice in the skillet alongside the fish for 1 minute, then plate with sliced cucumber, peeled egg, and a squeeze of lime if available.

Tools you’ll need

  • small pot
  • large skillet (12-inch or wider)
  • paper towels
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.