Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Bánh Chuối — Crispy Banana Fritters

Golden, crispy Vietnamese banana fritters made with a delicate rice-flour batter. Served warm with a touch of sweetness—a beloved street snack or light dessert.

Total time
20 min
Servings
2
Calories
285
Protein
2g
Bánh Chuối — Crispy Banana Fritters
casualindulgentvietnamesevegetariancrispyfluffysnackweekend

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Peel the bananas and place them on a cutting board. Slice each banana lengthwise down the middle, creating two long halves. Then slice each half crosswise into 3-inch-long pieces, about the size of your pinky finger.

  2. Step 2

    Pour the rice flour into a medium bowl. Add the sugar and salt to the flour, then stir with a fork or whisk until mixed evenly, about 15 seconds.

  3. Step 3

    Pour the water into the flour mixture slowly while whisking with a fork. Whisk until the batter looks smooth and thin, like pancake batter with no lumps, about 30 seconds.

  4. Step 4

    Pour the vegetable oil into a heavy-bottomed pot or deep skillet until it reaches a depth of 2 inches. Place the pot on the stove over medium-high heat and let it warm until the oil shimmers and a wooden spoon dipped in it produces steady bubbles, about 3 minutes.

  5. Step 5

    Working with one banana piece at a time, dip it into the batter to coat all sides. Carefully slide it into the hot oil—you should hear an immediate sizzle. Fry only 3–4 pieces at a time so they have room to move.

  6. Step 6

    Watch the banana pieces as they fry. After about 90 seconds, when the surface turns golden brown and crispy like caramelized sugar, use a slotted spoon to flip each one carefully.

  7. Step 7

    Fry the second side for another 90 seconds until it matches the first side—both sides should be a warm golden-brown color. Using the slotted spoon, lift each fritter out and place it on a paper-towel-lined plate.

  8. Step 8

    Repeat steps 5–7 with the remaining banana pieces, working in batches of 3–4. Allow the oil to return to a shimmering state between batches, about 30 seconds.

  9. Step 9

    Transfer the warm fritters to a serving plate or individual plates. Serve immediately while still crispy, within 5 minutes of frying for the best texture.

Tools you’ll need

  • cutting board
  • sharp knife
  • medium mixing bowl
  • fork or whisk
  • heavy-bottomed pot or deep skillet (3-quart minimum)
  • wooden spoon
  • slotted spoon or spider strainer
  • paper towels
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.