CookSnap is in beta — Get it free on TestFlight →
Back to recipes

20-Min Banh Mi Trung

Vietnamese egg banh mi with crispy baguette, pickled vegetables, and a runny yolk. Crunchy, tangy, deeply satisfying—ready in under 20 minutes.

Total time
20 min
Servings
2
Calories
385
Protein
14g
20-Min Banh Mi Trung
casualfreshvietnamesevegetarianeggscrispyrunnycrunchy

Ingredients

  • 2 whole eggs
  • 1 whole Vietnamese baguette or crusty baguette
  • ½ whole cucumber, julienned
  • ½ cup pickled carrots and daikon (jarred or quick-pickled)
  • ¼ cup cilantro and mint leaves, torn
  • 2 tbsp mayonnaise
  • 1 tbsp soy sauce or fish sauce

Instructions

  1. 1

    Halve the baguette lengthwise. Spread 1 tbsp mayo on each half.

  2. 2

    Heat oil in a skillet over medium-high until shimmering. Crack both eggs into the pan.

  3. 3

    Cook eggs until whites are set but yolks still jiggle, ~3 minutes. Season with salt and pepper.

  4. 4

    Layer pickled vegetables, cucumber, and herbs on the mayo-spread baguette bottoms.

  5. 5

    Slide both fried eggs onto the filled baguette halves, dividing evenly.

  6. 6

    Drizzle with soy sauce or fish sauce. Top with baguette halves and serve immediately.

Tools you’ll need

  • 12-inch non-stick or cast iron skillet
  • serrated knife for slicing baguette

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.