Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Banh Mi Trung

Vietnamese egg banh mi with crispy baguette, pickled vegetables, and a runny yolk. Crunchy, tangy, deeply satisfying—ready in under 20 minutes.

Total time
20 min
Servings
2
Calories
385
Protein
14g
20-Min Banh Mi Trung
casualfreshvietnamesevegetarianeggscrispyrunnycrunchy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Halve the baguette lengthwise. Spread 1 tbsp mayo on each half.

  2. Step 2

    Heat oil in a skillet over medium-high until shimmering. Crack both eggs into the pan.

  3. Step 3

    Cook eggs until whites are set but yolks still jiggle, ~3 minutes. Season with salt and pepper.

  4. Step 4

    Layer pickled vegetables, cucumber, and herbs on the mayo-spread baguette bottoms.

  5. Step 5

    Slide both fried eggs onto the filled baguette halves, dividing evenly.

  6. Step 6

    Drizzle with soy sauce or fish sauce. Top with baguette halves and serve immediately.

Tools you’ll need

  • 12-inch non-stick or cast iron skillet
  • serrated knife for slicing baguette

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.