Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Chicken Banh Mi

Shredded rotisserie chicken tossed with tangy pickled veggies and mayo, piled onto a crusty baguette with cilantro and jalapeño. Ready in 15 minutes, tastes like you ordered it from a corner stall in Hanoi.

Total time
15 min
Servings
2
Calories
485
Protein
32g
Crispy Chicken Banh Mi
casualfreshvietnamesechickencrispytendercrunchyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice the baguette in half lengthwise. Spread mayo inside both halves evenly.

  2. Step 2

    Toss shredded chicken with a squeeze of lime juice and a pinch of salt.

  3. Step 3

    Layer chicken on the bottom half, then pile pickled veggies on top.

  4. Step 4

    Top with fresh cilantro and jalapeño slices, then close with the top half.

  5. Step 5

    Press down gently, cut in half, and serve immediately with a cold beer.

Tools you’ll need

  • serrated knife
  • cutting board
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.