Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Bánh Pia with Mung Bean & Sesame

Crispy Vietnamese pastry pockets filled with sweet mung bean and sesame. These golden, flaky treats are baked until the edges curl and filled with a fragrant, slightly sweet paste that's authentic and deeply satisfying.

Total time
55 min
Servings
4
Calories
285
Protein
6g
Bánh Pia with Mung Bean & Sesame
wholesomeindulgentvietnamesevegetarianflakycrispycrumblyweekend

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Rinse mung beans and add to a pot with 2 cups water. Bring to boil, then simmer 25–30 minutes until very soft.

  2. Step 2

    Drain beans thoroughly. Mash with a fork until mostly smooth, leaving a few small pieces.

  3. Step 3

    Stir in sugar, sesame seeds, vanilla, and salt. Mix until the paste is even and fragrant.

  4. Step 4

    Let filling cool to room temperature, ~10 minutes.

  5. Step 5

    Preheat oven to 400°F. Line a baking sheet with parchment paper.

  6. Step 6

    Roll out thawed puff pastry on a lightly floured surface. Cut into 3-inch squares.

  7. Step 7

    Place 1 tsp filling in the center of each square. Fold corner to corner, forming a triangle.

  8. Step 8

    Press edges firmly with a fork to seal. Brush lightly with olive oil and water mixture.

  9. Step 9

    Sprinkle with black sesame seeds if using. Bake 15–18 minutes until deep golden and edges curl.

  10. Step 10

    Cool on the sheet 5 minutes, then transfer to a wire rack. Serve warm or at room temperature.

Tools you’ll need

  • large pot
  • baking sheet
  • parchment paper
  • fork (for mashing and sealing)
  • lightly floured surface or cutting board
  • oven thermometer (optional)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.