Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Mung Bean Banh Pia

Flaky Vietnamese pastries filled with sweet mung bean paste, sesame, and a hint of coconut. Crispy outside, creamy inside—baked in 20 minutes and perfect warm or at room temperature.

Total time
25 min
Servings
4
Calories
320
Protein
6g
Crispy Mung Bean Banh Pia
casualwholesomevietnamesevegetariandairy-freevegetariancrispyflaky

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Line a baking sheet with parchment paper.

  2. Step 2

    Thaw puff pastry sheets for 5 minutes. Mix mung bean paste, sesame seeds, and coconut in a bowl.

  3. Step 3

    Cut each pastry sheet into 4 squares. Place 2 tbsp filling in the center of each square.

  4. Step 4

    Fold each square into a triangle, then press and fold again into a small square. Press edges to seal.

  5. Step 5

    Whisk egg with water. Brush pastries with egg wash, then place on the baking sheet.

  6. Step 6

    Bake until golden brown and puffed, 12–15 minutes. Cool 2 minutes before serving.

Tools you’ll need

  • baking sheet
  • parchment paper
  • small mixing bowl
  • knife
  • small bowl (for egg wash)
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.