Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Banoffee Pie

A British classic: buttery biscuit base, sweet dulce de leche, fresh bananas, and whipped cream. No baking required—ready to serve in 15 minutes.

Total time
15 min
Servings
8
Calories
480
Protein
4g
Banoffee Pie
indulgentelegantbritishvegetariancrispycreamyfluffyDessert

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix crushed biscuits and melted butter in a bowl until resembles wet sand.

  2. Step 2

    Press firmly into a 9-inch pie dish, covering bottom and sides evenly.

  3. Step 3

    Spread dulce de leche over the crust in an even layer, about 1/2 inch thick.

  4. Step 4

    Slice bananas into 1/4-inch rounds and layer over dulce de leche.

  5. Step 5

    Whip cold cream and powdered sugar to stiff peaks, about 2 minutes.

  6. Step 6

    Dollop whipped cream over bananas or spread evenly across the top.

  7. Step 7

    Serve immediately, or refrigerate up to 1 hour before slicing.

Tools you’ll need

  • 9-inch pie dish
  • mixing bowl
  • spoon or offset spatula
  • electric mixer or whisk

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.