Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Torched Lemon Curd Tart with Meringue

No-bake lemon curd in a buttery graham crust, topped with torched Italian meringue. Tangy, sweet, and Instagram-worthy in under 30 minutes.

Total time
25 min
Servings
6
Calories
385
Protein
4g
Torched Lemon Curd Tart with Meringue
elegantindulgentfrenchvegetariancreamycrispyfluffyDessert

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix graham cracker crumbs with melted butter. Press firmly into the bottom and sides of a 9-inch tart pan.

  2. Step 2

    Whip heavy cream to soft peaks. Fold in lemon curd until fully combined and no streaks remain.

  3. Step 3

    Pour lemon-cream filling into crust. Chill while you make the meringue, about 5 minutes.

  4. Step 4

    Add egg whites and sugar to a heatproof bowl over simmering water, whisking constantly until sugar dissolves and mixture reaches 160°F, about 6 minutes.

  5. Step 5

    Remove from heat. Beat with an electric mixer until stiff, glossy peaks form, about 4 minutes.

  6. Step 6

    Spread or pipe meringue thickly over filling. Use a kitchen torch to toast peaks golden brown until they blister.

  7. Step 7

    Serve immediately or chill up to 2 hours before torching.

Tools you’ll need

  • 9-inch tart pan
  • heatproof bowl
  • whisk
  • electric mixer
  • kitchen torch
  • rubber spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.