Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Basket Chaat

Crispy fried potato baskets filled with spiced chickpeas, yogurt, and chutneys—a street-food favorite that's surprisingly doable at home. Tangy, spicy, and completely vegetarian.

Total time
35 min
Servings
2
Calories
420
Protein
11g
Basket Chaat
casualindulgentindianvegetarianchickpeascrispycreamycrunchy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut potatoes in half lengthwise. Using a small knife, carefully hollow out each half, leaving a thin shell for the basket.

  2. Step 2

    Pat potato baskets dry with paper towels — moisture is the enemy when frying.

  3. Step 3

    Toss drained chickpeas with red chili powder, cumin seeds, tamarind paste, and salt to taste.

  4. Step 4

    Heat oil in a deep pan to 350°F (a wooden spoon handle will bubble steadily when oil is ready).

  5. Step 5

    Carefully slide potato baskets into hot oil. Fry 3–4 minutes until golden and crispy all over.

  6. Step 6

    Remove baskets with a slotted spoon. Drain on paper towels. Season lightly with salt while still hot.

  7. Step 7

    Place a crispy potato basket on a plate. Spoon spiced chickpeas into the hollow center.

  8. Step 8

    Dollop yogurt over the top. Serve immediately while the basket is still warm and crispy.

Tools you’ll need

  • cutting board and sharp knife
  • small paring knife
  • paper towels
  • deep saucepan or wok (at least 4 inches deep)
  • candy thermometer or instant-read thermometer
  • wooden spoon
  • slotted spoon
  • paper towel-lined plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.