Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Puchka with Tangy Spiced Water

Hollow, crispy fried shells filled with spiced potato, chickpeas, and fresh herbs, served with tangy tamarind-mint water. This street-food favorite comes together in 25 minutes with store-bought shells as the shortcut.

Total time
25 min
Servings
2
Calories
165
Protein
5g
Crispy Puchka with Tangy Spiced Water
casualfreshindianvegetarianchickpeascrispycrunchyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Make the tangy water: whisk tamarind paste, mint, chili powder, salt, and 1 cup water until the paste dissolves completely and the water turns golden-brown.

  2. Step 2

    Toss diced potato and chickpeas together in a small bowl with a pinch of salt and black pepper.

  3. Step 3

    Hold each puchka shell gently and make a small hole in the top with your thumb, being careful not to crack it.

  4. Step 4

    Spoon 1 tbsp of the potato-chickpea mixture into each shell, packing it in lightly.

  5. Step 5

    Arrange filled shells on a plate and pour the tangy water into a small cup alongside for dipping.

  6. Step 6

    Dip each puchka into the tangy water, pop it in your mouth, and let the shell shatter on your tongue.

Tools you’ll need

  • small mixing bowl
  • small cup or dipping bowl
  • spoon
  • whisk
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.