Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

BBQ Beef Chili

Smoky, meaty chili built on ground beef, BBQ sauce, and beans—ready in 20 minutes. One skillet, zero fuss, maximum flavor.

Total time
20 min
Servings
6
Calories
412
Protein
32g
BBQ Beef Chili
comfortheartyamericanbeeftenderheartyweeknightgame-day

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a large skillet over medium-high heat until shimmering, about 90 seconds.

  2. Step 2

    Brown ground beef, breaking it up with a spoon, until no pink remains, about 6 minutes.

  3. Step 3

    Stir in BBQ sauce, beans, tomatoes with green chiles, and beef broth until combined.

  4. Step 4

    Simmer uncovered for 8 minutes, stirring occasionally, until flavors meld and chili thickens.

  5. Step 5

    Stir in hot sauce if you want extra heat; taste and season with salt and pepper.

  6. Step 6

    Serve hot in bowls. Top with shredded cheddar, sour cream, or onions if desired.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.