Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

BBQ Brisket Stuffed Baked Potato

Crispy-skinned baked potato loaded with shredded BBQ brisket, melted cheddar, and sour cream. Ready in under 20 minutes using store-bought smoked brisket.

Total time
18 min
Servings
2
Calories
720
Protein
42g
BBQ Brisket Stuffed Baked Potato
comfortsatisfyingamericanbeefcrispytendercreamyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Microwave potatoes on high for 8 minutes, turning halfway through. Skin should feel tender when pierced.

  2. Step 2

    Heat brisket with BBQ sauce in a small skillet over medium-high for 2 minutes, stirring occasionally, until warm.

  3. Step 3

    Split potatoes in half lengthwise. Scoop out centers slightly to create a shallow well, leaving a thin wall.

  4. Step 4

    Divide BBQ brisket between potato halves. Top each with 0.25 cup cheddar, spreading evenly.

  5. Step 5

    Broil 4 inches from heat for 3 minutes until cheese melts and begins to brown at edges.

  6. Step 6

    Top with a dollop of sour cream and scatter scallions over. Serve hot.

Tools you’ll need

  • microwave-safe plate
  • small skillet
  • broiler pan or rimmed sheet pan
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.